Protein Info for MIT1002_04034 in Alteromonas macleodii MIT1002

Annotation: Cytochrome c oxidase subunit 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 transmembrane" amino acids 49 to 69 (21 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 173 to 200 (28 residues), see Phobius details amino acids 212 to 239 (28 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details amino acids 295 to 319 (25 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details amino acids 403 to 425 (23 residues), see Phobius details amino acids 437 to 461 (25 residues), see Phobius details amino acids 481 to 501 (21 residues), see Phobius details TIGR02891: cytochrome c oxidase, subunit I" amino acids 37 to 541 (505 residues), 708.7 bits, see alignment E=2.1e-217 PF00115: COX1" amino acids 45 to 487 (443 residues), 545.1 bits, see alignment E=6.4e-168

Best Hits

Swiss-Prot: 55% identical to COX1_RHILE: Cytochrome c oxidase subunit 1 (ctaD) from Rhizobium leguminosarum

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 98% identity to amc:MADE_04012)

MetaCyc: 76% identical to cytochrome c oxidase subunit 1 (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (542 amino acids)

>MIT1002_04034 Cytochrome c oxidase subunit 1 (Alteromonas macleodii MIT1002)
MSKATEVISPDTSAPHDGHLHDDHEHHDHIPKGITRWLFTTNHKDIGTLYLWFAFIMFLV
GGAMAMVIRAELFQPGLQIVEPNFFNQMTTVHGLIMVFGAVMPAFTGLANWLIPMMIGAP
DMALPRMNNWSFWILPGAFLILLSSLFMEGGGPAFGWTFYAPLSTTYSGDSTALFVFSVH
IMGISSIMGAINVIVTIFNMRAPGMTWMKMPLFVWTWLITAFLLIAVMPVLAGAVTMVLT
DKFFGTSFFDAAGGGDPVMFQHIFWFFGHPEVYIMILPAFGIISQIVPTFSRKQLFGYAS
MVYATASIALLSFVVWAHHMFTTGMPVYMEMFFMFATMLISVPTGVKVFNWVATMWRGSL
SFEMPMMFAIAFIVLFTIGGLSGLMLAITPVDFQYHDTYFVVAHFHYVLVTGAVFSIMAA
VYYWLPKWTGKMYDTTLAKWHFWCSLVSVNVLFFPMHFVGLAGMPRRIPDYALQFADFNK
WISLGGFAFGLSQLIFLALLIKACKKQGEPVSAQVWDGAEGLEWEIPSPAPYHTFETPPV
VK