Protein Info for MIT1002_04032 in Alteromonas macleodii MIT1002

Annotation: Cytochrome c oxidase subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00510: COX3
  • amino acids 13 to 125 (113 residues), 44.7 bits, E=8.2e-16
  • amino acids 152 to 296 (145 residues), 132 bits, E=1.9e-42

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 96% identity to amc:MADE_04010)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
• arsenite to oxygen electron transfer (1/2 steps found)
• arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Protein Sequence (297 amino acids)

>MIT1002_04032 Cytochrome c oxidase subunit 3 (Alteromonas macleodii MIT1002)
MQPEVQNHEYQKYYVPAQSPWPIVGAVALFLIAVGAGNYVVQATKGETGYGGHILLAGIA
VLLVMLVGWFKNQIDESMAGLYSDQLGRSYRQGMSWFIFSEVMFFAAFFGALYYARFISV
PWLGGASNNAMTNEVLWPTFEAMWPLVSTPGGTTTQEMSAAGLPTINTVILLISSITLHF
AHVGLEQNKRKQLTLMLGITILLGCGFLFLQVEEYIHAYRDLGLTLQSGIYGNTFFMLTG
FHGMHVTLGTIILIVLFFRVLKGHFTPENHFAFQAGSWYWHFVDVVWVMLYIFVYVL