Protein Info for MIT1002_04016 in Alteromonas macleodii MIT1002

Annotation: Pimelyl-[acyl-carrier protein] methyl ester esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 TIGR01738: pimelyl-[acyl-carrier protein] methyl ester esterase" amino acids 17 to 259 (243 residues), 263 bits, see alignment E=1.4e-82 PF12697: Abhydrolase_6" amino acids 21 to 254 (234 residues), 86.2 bits, see alignment E=1.1e-27 PF12146: Hydrolase_4" amino acids 21 to 243 (223 residues), 48.9 bits, see alignment E=1.1e-16 PF00561: Abhydrolase_1" amino acids 21 to 249 (229 residues), 105.1 bits, see alignment E=9.7e-34

Best Hits

Swiss-Prot: 48% identical to BIOH_AERHH: Pimeloyl-[acyl-carrier protein] methyl ester esterase (bioH) from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)

KEGG orthology group: K02170, biotin biosynthesis protein BioH (inferred from 92% identity to amc:MADE_03993)

Predicted SEED Role

"Biotin synthesis protein BioH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>MIT1002_04016 Pimelyl-[acyl-carrier protein] methyl ester esterase (Alteromonas macleodii MIT1002)
MESLHTNGELVTRTQGTGVDVVFLHGWGMNSGAFTSFIPYLSDNFRVTTIDLPGFGENAE
FVPSPYNVETLAQSIVNQLPNQCVLVGWSLGGLVAQKLALLAPEKLTGLVTIASTPRFIA
GPCWPGIAADLLSMFETQLEKNYQKTLERFLAIQAMGSETAKQDIKAIREQVTQFPDPAE
EALKKGLRILSTEDMRQDVGRITTPTLRLYGRLDSLVPTSGIDRICELHPQADTVVLPHA
SHAPFISHPQQTADILFRFAAGVYQQKAS