Protein Info for MIT1002_03981 in Alteromonas macleodii MIT1002

Annotation: Putative general secretion pathway protein I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07963: N_methyl
  • amino acids 19 to 43 (25 residues), 28.7 bits, 6.9e-11
• TIGR02532: prepilin-type N-terminal cleavage/methylation domain
  • amino acids 21 to 43 (23 residues), 20.2 bits, 4e-08
• TIGR01707: type II secretion system protein I
  • amino acids 23 to 120 (98 residues), 89.4 bits, E=1.9e-29
• PF02501: T2SSI
  • amino acids 58 to 135 (78 residues), 97 bits, E=5.5e-32

Best Hits

Swiss-Prot: 40% identical to GSPI_AERHY: Type II secretion system protein I (exeI) from Aeromonas hydrophila

KEGG orthology group: K02458, general secretion pathway protein I (inferred from 80% identity to alt:ambt_21405)

Predicted SEED Role

"General secretion pathway protein I"

Protein Sequence (142 amino acids)

>MIT1002_03981 Putative general secretion pathway protein I (Alteromonas macleodii MIT1002)
MSAPTVKASAKKVGAKTPRYQSGLTLLEVMVALLIFALTGTAVLKAAGEHLSSVGQIESV
TFANWVASNRLNQLQLDTTWPPKNNLKGTMEMADRTWYWQQTVTKTNDNDLRSVTVSVGE
DESYGSSVTSVTTFVAKPTAGN