Protein Info for MIT1002_03925 in Alteromonas macleodii MIT1002

Annotation: Protoheme IX farnesyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 62 (25 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 211 to 227 (17 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 6 to 285 (280 residues), 275.8 bits, see alignment E=2.7e-86 PF01040: UbiA" amino acids 22 to 268 (247 residues), 188.6 bits, see alignment E=6.3e-60

Best Hits

Swiss-Prot: 74% identical to CYOE1_PSEHT: Protoheme IX farnesyltransferase 1 (cyoE1) from Pseudoalteromonas haloplanktis (strain TAC 125)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 96% identity to amc:MADE_03908)

MetaCyc: 62% identical to heme O synthase (Escherichia coli K-12 substr. MG1655)
HEMEOSYN-RXN [EC: 2.5.1.141]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.141

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>MIT1002_03925 Protoheme IX farnesyltransferase (Alteromonas macleodii MIT1002)
MTSTYKRYLSVTKPGIIMGNAISVTGGFLLASRGDIDYWLLLATLIGLSLVVASGCVINN
CIDRDIDGKMQRTANRVTVTGELPLLTAMLHGAVLGIAGFGLLALYTNLTAVFFAAFGYV
IYVGVYSLYMKRNSVYGTFVGSLSGAVPPVVGYCAASGQFDMAAAILLGMFSIWQMPHSY
AIAIFRYNDYKAAGIPVLPVSQGIAKAKRHIVLHVALFALVVMLLPLSGYTGIGFLTVAF
ATSLWWLLMALRGYRPDINVEGWAKRVFGFSIVNITLLSVAMSLDYHTSVTSLFTLSF