Protein Info for MIT1002_03808 in Alteromonas macleodii MIT1002

Annotation: 6-N-hydroxylaminopurine resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF03473: MOSC" amino acids 50 to 162 (113 residues), 111.5 bits, see alignment E=1.3e-36

Best Hits

Swiss-Prot: 32% identical to Y278_HAEIN: Uncharacterized protein HI_0278 (HI_0278) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 87% identity to amc:MADE_03773)

Predicted SEED Role

"Uncharacterized protein conserved in bacteria"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>MIT1002_03808 6-N-hydroxylaminopurine resistance protein (Alteromonas macleodii MIT1002)
MSTSFSVNALFAGKPQPLGPRGAPSSIVKAPVDALTVHMDRTDEDEQANKRLHGGPEKVL
HQFNPTNYLTLRKHFPEGDFSLGSIGENISVEGMDDATVYIGDIWKFGEVELQVSAPRAP
CNKISQRFEVPNLDRFVGERGITGWYYRVIKTGTISVGDEVTLLHREDDTVNVHTLMQCA
HTKADKALAQKLANLEALDDEWRGKCQKIADKIADK