Protein Info for MIT1002_03789 in Alteromonas macleodii MIT1002

Annotation: tRNA dimethylallyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 TIGR00174: tRNA dimethylallyltransferase" amino acids 11 to 296 (286 residues), 354.9 bits, see alignment E=1.6e-110 PF01745: IPT" amino acids 11 to 64 (54 residues), 21.8 bits, see alignment E=1.1e-08 PF01715: IPPT" amino acids 45 to 287 (243 residues), 312.4 bits, see alignment E=2.5e-97

Best Hits

Swiss-Prot: 61% identical to MIAA_PSEA6: tRNA dimethylallyltransferase (miaA) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K00791, tRNA dimethylallyltransferase [EC: 2.5.1.75] (inferred from 94% identity to amc:MADE_00648)

MetaCyc: 58% identical to tRNA dimethylallyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6274 [EC: 2.5.1.75]

Predicted SEED Role

"tRNA dimethylallyltransferase (EC 2.5.1.75)" (EC 2.5.1.75)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>MIT1002_03789 tRNA dimethylallyltransferase (Alteromonas macleodii MIT1002)
MSNGINSALPVIAIMGPTASGKTGLALDIAAKVESEVISVDSALVYKGMDIGTAKPTQEE
QAGVVHHLIDIIDPAQSYSVSQFVNDTNALIGDILARGKVPILAGGTMMYFNALINGISP
LPKSDEKIRDEITQQAQRLGWSKLHDELRGVDPISGERIHPNDPQRITRALEVYRSTGKT
LTHWQQQEGEKCPYNITQFAIAPADRTVLHERIATRFDMMLEQGFEKEVVKLYERSDLHE
DLPSVRSVGYRQMWQYLDGQLSYAEMRERGIIATRQLAKRQLTWLRGWEQVTWLDTFAND
NLTKITAKVTL