Protein Info for MIT1002_03710 in Alteromonas macleodii MIT1002

Annotation: Nickel uptake substrate-specific transmembrane region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF10670: DUF4198" amino acids 23 to 254 (232 residues), 178.7 bits, see alignment E=8.9e-57

Best Hits

KEGG orthology group: None (inferred from 63% identity to cja:CJA_2536)

Predicted SEED Role

"Nikel transport family protein NikM"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>MIT1002_03710 Nickel uptake substrate-specific transmembrane region (Alteromonas macleodii MIT1002)
MKKLSVKASAIALAATLAVSFSASAHRAWLLPSSTVLSGEEAYVTFDAAISNTIFHPDHF
AMNASNLVVQSPEGEAVDVENMARGKYRTTFDLKLNKEGTYKLTSASNGIRAFWRDEEGK
RKMWPGRGEEYKPEEFATAVPKKAKDLRVMQSSRRVETFVTLGAPSNKVFTPDNVGLELV
PVTHPNDLFATETATFKLLIDGEPAVGAEVEVVRGGMRYRNDQETIKVTSDKNGQIEITW
PQAGMYFVEIGYEDDKAQKPATSRNGSYSGTFEVLPL