Protein Info for MIT1002_03692 in Alteromonas macleodii MIT1002

Annotation: Poly(A) polymerase I precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 TIGR01942: poly(A) polymerase" amino acids 2 to 433 (432 residues), 527.2 bits, see alignment E=1.5e-162 PF01743: PolyA_pol" amino acids 32 to 167 (136 residues), 125.9 bits, see alignment E=1.9e-40 PF12627: PolyA_pol_RNAbd" amino acids 195 to 257 (63 residues), 75.4 bits, see alignment E=3.6e-25 PF12626: PolyA_pol_arg_C" amino acids 312 to 433 (122 residues), 132.6 bits, see alignment E=1.1e-42

Best Hits

Swiss-Prot: 56% identical to PCNB_ECOLI: Poly(A) polymerase I (pcnB) from Escherichia coli (strain K12)

KEGG orthology group: K00970, poly(A) polymerase [EC: 2.7.7.19] (inferred from 95% identity to amc:MADE_03548)

MetaCyc: 56% identical to poly(A) polymerase I (Escherichia coli K-12 substr. MG1655)
Polynucleotide adenylyltransferase. [EC: 2.7.7.19]

Predicted SEED Role

"Poly(A) polymerase (EC 2.7.7.19)" in subsystem Polyadenylation bacterial (EC 2.7.7.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>MIT1002_03692 Poly(A) polymerase I precursor (Alteromonas macleodii MIT1002)
MTRGEHGISREDVSANALKVMYRLNGAGFESYLVGGCVRDILMGHEPKDFDVVTNATPEQ
IKGLFRNCRLIGRRFRLAHIVFGREIIEVATFRGHHQESDEDENLPKGKAVAKRDAHGQL
VRDNVFGTIEEDAERRDFTFNAMYYSVADFTVKDFANGLAAIEKREVELIGDPETRYRED
PVRMLRAVRFAVKLGMRIEAKTAAPIKSLANLLQNIPPARLFEETLKLFLSGKGEETFLM
LHEYGLIEPLFPQLTPFLKDENSREMQFVRRVLANTDERINSDQRVTPAFLYAALLWYPV
EEESQRLQSESGLNAHDAFNIASGEVIARQTQRIMIPKRFSTVVRDIWILQQRLPKRFGR
RAFQLLTHPKFRAGYDFLLARGQIEGGDLLELAQWWTHFQHADNGKQKGMLNALRKSEGG
AKGAPRKRKRKPAKRGPDA