Protein Info for MIT1002_03689 in Alteromonas macleodii MIT1002

Annotation: Sugar fermentation stimulation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 TIGR00230: sugar fermentation stimulation protein" amino acids 1 to 237 (237 residues), 212.8 bits, see alignment E=2.2e-67 PF17746: SfsA_N" amino acids 13 to 80 (68 residues), 86.1 bits, see alignment E=1.4e-28 PF03749: SfsA" amino acids 85 to 226 (142 residues), 133.8 bits, see alignment E=3.7e-43

Best Hits

Swiss-Prot: 90% identical to SFSA_ALTMD: Sugar fermentation stimulation protein homolog (sfsA1) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K06206, sugar fermentation stimulation protein A (inferred from 90% identity to amc:MADE_03544)

Predicted SEED Role

"Sugar/maltose fermentation stimulation protein homolog" in subsystem Fermentations: Mixed acid

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>MIT1002_03689 Sugar fermentation stimulation protein A (Alteromonas macleodii MIT1002)
MKFSPSLLRGTLIKRYKRFLADVELDDGTIVTAHCPNTGAMTGCAVPGYTVFLSESTNPN
RKLKYTWELAQTFDGHFIGINTHNANKLVAEALDNKVLSEFSDITDWKAEVTPPTANSRF
DFALTRKNAEHQSVTEYMEVKSVTLADENKGFFPDAVTQRGAKHCLELARLSDSGIKTSL
LFCVQHTAIESVQVAEHIDPTYAESVKIAADAGVTVLAASCIIDEQKILLNQTLPLIL