Protein Info for MIT1002_03640 in Alteromonas macleodii MIT1002

Annotation: Iron-regulated outer membrane proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 705 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF07715: Plug" amino acids 41 to 144 (104 residues), 67.7 bits, see alignment E=1.2e-22 PF00593: TonB_dep_Rec_b-barrel" amino acids 236 to 670 (435 residues), 105.3 bits, see alignment E=7.6e-34

Best Hits

KEGG orthology group: None (inferred from 74% identity to pha:PSHAb0286)

Predicted SEED Role

"Aerobactin siderophore receptor IutA" in subsystem Iron acquisition in Vibrio or Siderophore Aerobactin or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (705 amino acids)

>MIT1002_03640 Iron-regulated outer membrane proteins (Alteromonas macleodii MIT1002)
MFRPSLTLIALAVSAPSFANDAQKDMERIIVSGSRVIESIDEVPASITVISRKQIEDHLK
VNPELQSLLAQMVPGLAPDTGSSSNTGQSLRGRAPLVMIDGVPQSTPLRNGSLGVKTIDP
SALARIEVIKGATSVYGNGASGGIINYITKQATAQDTHEGQVSLSSRFSAVKLEESAGAR
ISAAINGKVENFDYLVTASYEENGVQRDAEGDILGLQYGLSDAETQNYFTKLGYDFDQEK
RLQFSYNYFSSQQKTDLGDVPGDINEGVKTYAIHVPEALQKRGKPQGPDGNENITLKYTD
SNIFVNSEMTLDVYSQDIENVFFFSPNLANPDEGYDGGQSIIRSEKRGARATFNTAIDFD
GVEATFIYGIDALKDTTSQPLVDGRVWVPEMEMDSLAGFLQTKWVIHDDLIVKAGVRRES
IDLSVDDYETLKLCRSETQCSVPLQVKGDTIDYDATTYNIAIKYNWSDSFSPFFNYSQGS
DIADIGRLLRAATVDDIGLIQTEASIIDNYEVGFTSLFDQVRLEVAAYRSTSELGTTNSF
NEVTGVYEPVRAPQEIWGYEGLVDYRISETLNVVATYSYVEGKNTEADVYLGSRQISPPK
ATANVNWKPSDTLSLTVSYLYVGDRKRFSPNADGDYVGDQGPISSYNIVNLSGQYQFAEN
WNAFMGVENLFNSDYYPARAQSYTYGGYNIKGLGTTATLGVTYSF