Protein Info for MIT1002_03619 in Alteromonas macleodii MIT1002

Annotation: Phytochrome-like protein cph1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 907 PF08446: PAS_2" amino acids 14 to 128 (115 residues), 33.6 bits, see alignment E=1.9e-11 PF01590: GAF" amino acids 162 to 320 (159 residues), 39.5 bits, see alignment E=2.8e-13 PF00360: PHY" amino acids 341 to 501 (161 residues), 78.8 bits, see alignment E=1.2e-25 PF00512: HisKA" amino acids 531 to 596 (66 residues), 53.9 bits, see alignment 5.4e-18 PF02518: HATPase_c" amino acids 643 to 753 (111 residues), 105.5 bits, see alignment E=7.7e-34 PF14501: HATPase_c_5" amino acids 648 to 737 (90 residues), 23.4 bits, see alignment E=1.8e-08 PF00072: Response_reg" amino acids 783 to 898 (116 residues), 75.7 bits, see alignment E=1.2e-24

Best Hits

KEGG orthology group: None (inferred from 88% identity to amc:MADE_03481)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)" in subsystem Oxidative stress or Oxygen and light sensor PpaA-PpsR (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (907 amino acids)

>MIT1002_03619 Phytochrome-like protein cph1 (Alteromonas macleodii MIT1002)
MQTIDNTPTTLQNCEDEAIHLIESVQSFGYVIAINPSTKKIQVVSENINDMFNVDVVPGE
TLITELIDIPSPEARTFQTIHDAVKGGNVRHAYQWKFAENALHLKDWEKEGSGVAFDSNG
LLVIELEPTPQLSFEAAQQWVPMDVDIRALLPNVDDRDSIGDVADAIAQVFKQYIGFDSV
MVYQFDKTYCGEVIGEAASADSRSFKGLKFPASDIPSQARELYLKNRVRCVYDVEEQVIG
LKPSVKEAERPPLDLSMSMVRSVSPMHIAYLKNMGIRSSFSVSLVFEGKLWGLLACHNSE
PAYIDQKKRLVCESLGHLYAWQLHTKALHKKKEQFQIRQRKLNHIVHQLTSYTNPLEAIT
QKEGDLLDVADSCGMAVVTPTGNYLVGKTPTEKTLAKLLEKFAISGSEQSIAINRLTNEI
LDSGDLNGIRGMYISCVSSKLGYYTVWFREQKDKTIRWAGRDAARKDIGKSLTPRNSFDM
YLQSVADESVEWTEDDQLIIEGFDHLFIPYALSLKASLDKQISKLEELDKAKDQFLASIS
HELRSPLNSIVGWTDLALMDVGNVDRMTDALGVIKRAASTQAALINDILDLSRIISGTMK
LSTHSLNIAGSISEVAKSFEAGFASKNIQLSINCEDDHTQILGDNLRIKQVINNLLSNAL
KFTSKGGTVHVRGRREHSNYLFRVKDNGKGMTREQLSHVFERFYQGKNEHNKHGLGLGLS
IVKSLVEMHGGEIYAESDGPNTGTTFYVTLPIAPLNLHDDIIETKNSEISDLTESLRLNG
LRILVAEDEQDARDFIKLFLESNGARVNVVKNGLLAWKEINDMPEAFDLLLSDIGMPEMD
GLGLVLKIRASEIPEIAKLNAVALTAYAYTSDRVKALKAGFNNYVSKPVDGEELLTILEM
YLPETSH