Protein Info for MIT1002_03597 in Alteromonas macleodii MIT1002

Annotation: 30S ribosomal protein S8

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 PF00410: Ribosomal_S8" amino acids 5 to 129 (125 residues), 161.6 bits, see alignment E=4.2e-52

Best Hits

Swiss-Prot: 100% identical to RS8_ALTMD: 30S ribosomal protein S8 (rpsH) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K02994, small subunit ribosomal protein S8 (inferred from 100% identity to amc:MADE_00952)

MetaCyc: 77% identical to 30S ribosomal subunit protein S8 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S8p (S15Ae)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>MIT1002_03597 30S ribosomal protein S8 (Alteromonas macleodii MIT1002)
MSMQDPIADMFTRIRNGQMAQKVSVTMPSSKLRVAICEVLKAEGYITDFAASGDVKPVLE
VTLKYFEGKQVIDTIERVSRPGLRIYKKKDELPKVMGGLGVAIVSTSKGVMTDRAARNAG
MGGEIIGYVA