Protein Info for MIT1002_03596 in Alteromonas macleodii MIT1002

Annotation: 50S ribosomal protein L6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03654: ribosomal protein uL6
  • amino acids 2 to 176 (175 residues), 245.3 bits, E=1.6e-77
• PF00347: Ribosomal_L6
  • amino acids 13 to 82 (70 residues), 55.9 bits, E=3.1e-19
  • amino acids 91 to 164 (74 residues), 87.7 bits, E=3.7e-29

Best Hits

Swiss-Prot: 96% identical to RL6_ALTMD: 50S ribosomal protein L6 (rplF) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K02933, large subunit ribosomal protein L6 (inferred from 96% identity to amc:MADE_00953)

MetaCyc: 69% identical to 50S ribosomal subunit protein L6 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L6p (L9e)" in subsystem Ribosome LSU bacterial

Protein Sequence (177 amino acids)

>MIT1002_03596 50S ribosomal protein L6 (Alteromonas macleodii MIT1002)
MSRIAKAPVDVVSGVEVSISGQEVTVKGSKGTLTRVFNDAVEVAQEENQLKALPREGFVD
GWAQAGTARSILNAMVQGVSEGFEKKLQLLGVGYRAQAQGNKLNLTLGFSHPVAYEMPEG
ITVETPSQTEIVVKGADKQVVGQVAANIRGYRPPEPYKGKGVRYADEHVRRKEAKKK