Protein Info for MIT1002_03584 in Alteromonas macleodii MIT1002

Annotation: 50S ribosomal protein L17

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00059: ribosomal protein bL17
  • amino acids 7 to 117 (111 residues), 163.1 bits, E=1.3e-52
• PF01196: Ribosomal_L17
  • amino acids 20 to 116 (97 residues), 133.7 bits, E=1.8e-43

Best Hits

Swiss-Prot: 100% identical to RL17_ALTMD: 50S ribosomal protein L17 (rplQ) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K02879, large subunit ribosomal protein L17 (inferred from 98% identity to alt:ambt_19040)

MetaCyc: 83% identical to 50S ribosomal subunit protein L17 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L17p" in subsystem Ribosome LSU bacterial

Protein Sequence (133 amino acids)

>MIT1002_03584 50S ribosomal protein L17 (Alteromonas macleodii MIT1002)
MRHRKSGRQLNRNSSHRQAMFKNMAGSLVKHEVIKTTLPKAKELRRVIEPLITMAKEDSV
ANRRLAFARTGDKEVVGKLFNELGPRYEARPGGYTRILKCGFRAGDNAPMAYVELVDRPV
VEAEEEAVEATEE