Protein Info for MIT1002_03493 in Alteromonas macleodii MIT1002

Annotation: Arginine repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01316: Arg_repressor
  • amino acids 5 to 72 (68 residues), 72.8 bits, E=1.6e-24
• TIGR01529: arginine repressor
  • amino acids 11 to 150 (140 residues), 144 bits, E=1.7e-46
• PF02863: Arg_repressor_C
  • amino acids 81 to 148 (68 residues), 77.8 bits, E=4.6e-26

Best Hits

Swiss-Prot: 79% identical to ARGR_COLP3: Arginine repressor (argR) from Colwellia psychrerythraea (strain 34H / ATCC BAA-681)

KEGG orthology group: K03402, transcriptional regulator of arginine metabolism (inferred from 98% identity to amc:MADE_00735)

Predicted SEED Role

"Arginine pathway regulatory protein ArgR, repressor of arg regulon" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation

Protein Sequence (154 amino acids)

>MIT1002_03493 Arginine repressor (Alteromonas macleodii MIT1002)
MANAKQELLIKAFKEILKAESYGSQGEIVDALKAQGFDNISQSKISRMLSKFGAVRTRNA
RGDMVYCLPPELGMPTAKSPLKQLVLDIVHNNVMVIIRTSPGAAQLIARLLDSLSKKDGV
LGTIAGDDTIFIAPADVARIEELRQRVEDLFENV