Protein Info for MIT1002_03489 in Alteromonas macleodii MIT1002

Annotation: Putative reductase/y4119/YP_4011

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF12242: Eno-Rase_NADH_b" amino acids 2 to 80 (79 residues), 128.6 bits, see alignment E=9.2e-42 PF12241: Enoyl_reductase" amino acids 82 to 317 (236 residues), 373 bits, see alignment E=8.5e-116 PF07055: Eno-Rase_FAD_bd" amino acids 323 to 386 (64 residues), 89.1 bits, see alignment E=2.9e-29

Best Hits

Swiss-Prot: 80% identical to FABV_PSEA6: Enoyl-[acyl-carrier-protein] reductase [NADH] (fabV) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: None (inferred from 97% identity to amc:MADE_00744)

Predicted SEED Role

"Uncharacterized paraquat-inducible protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>MIT1002_03489 Putative reductase/y4119/YP_4011 (Alteromonas macleodii MIT1002)
MVIKPKVRGFICTNAHPVGCAKAVEEQIAYVEAKGDLGEGPKNVLVIGSSTGYGLASRIT
SAFGYGAKTLGVCFEKAPTERKTGTAGWYNTAAFHEKAKAKGLYAETINGDAFSDEIKNE
AIDKIKAEMGKVDLVIYSLASPRRTDPETGVTYKSTLKPVGQAYTTKTYDTDKDKVHEVS
LEPANDEEILNTIKVMGGEDWERWMDFLREADVLAEGCKTTAYTYIGKELTWPIYGQATI
GKAKEDLDRAAAAIIGKNSDLLVQANVSSLKALVTQASSAIPVMPLYISLIYKVMKEEGT
HEGCIEQIHGLFTQCLFGNTPTLDEANRYRMDGKETNDATQAKIKALWDQVTQENFHDLS
DYKGYNHEFLKLFGFDISSVDYDSEVDPMVNW