Protein Info for MIT1002_03479 in Alteromonas macleodii MIT1002

Annotation: Antitoxin ParD1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 80 TIGR02606: putative addiction module antidote protein, CC2985 family" amino acids 11 to 71 (61 residues), 70.4 bits, see alignment E=5.1e-24 PF03693: ParD_antitoxin" amino acids 13 to 78 (66 residues), 59.4 bits, see alignment E=1.9e-20

Best Hits

Swiss-Prot: 43% identical to PARD_VIBCH: Antitoxin ParD (parD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07746, hypothetical protein (inferred from 57% identity to hch:HCH_04560)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (80 amino acids)

>MIT1002_03479 Antitoxin ParD1 (Alteromonas macleodii MIT1002)
MARTITFQPSRSMSEFIEAMVSSGNYNNQSEVIRAALRLLQEQDASSKLNALRLLIEEGE
QSEDDINFSMDSLKKRLDSR