Protein Info for MIT1002_03474 in Alteromonas macleodii MIT1002

Annotation: Thermoresistant gluconokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 PF01583: APS_kinase" amino acids 6 to 112 (107 residues), 24 bits, see alignment E=7e-09 PF13671: AAA_33" amino acids 6 to 124 (119 residues), 39.9 bits, see alignment E=1e-13 TIGR01313: carbohydrate kinase, thermoresistant glucokinase family" amino acids 8 to 164 (157 residues), 164.1 bits, see alignment E=1.2e-52 PF13238: AAA_18" amino acids 8 to 122 (115 residues), 37.7 bits, see alignment E=5.5e-13 PF01202: SKI" amino acids 14 to 130 (117 residues), 37.7 bits, see alignment E=4.7e-13

Best Hits

KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 40% identity to ssl:SS1G_06687)

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (172 amino acids)

>MIT1002_03474 Thermoresistant gluconokinase (Alteromonas macleodii MIT1002)
MTHCHVFFVSGVSGTGKSTLSQHLAQRFDMPFEEGDRYHSEANVEKMSSGIPLQDADRWE
WLITLNMIAKQHIHAGRNVVISCSALRSAYRDVLTKDIAPHCHFIYLHASQSVLSARLKQ
REHFFNGDAMLESQFAALELPSKDNAFIIDVTQTFECVSQQAEDFIRPLISN