Protein Info for MIT1002_03466 in Alteromonas macleodii MIT1002

Annotation: Putative aminoacrylate peracid reductase RutC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03610: pyrimidine utilization protein C
  • amino acids 12 to 138 (127 residues), 247.6 bits, E=1.1e-78
• PF01042: Ribonuc_L-PSP
  • amino acids 25 to 136 (112 residues), 114.1 bits, E=2.1e-37

Best Hits

Swiss-Prot: 84% identical to RUTC_PSE14: Putative aminoacrylate peracid reductase RutC (rutC) from Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)

KEGG orthology group: K09021, UPF0076 protein RutC (inferred from 98% identity to amc:MADE_00762)

MetaCyc: 70% identical to 3-aminoacrylate deaminase (Escherichia coli K-12 substr. MG1655)
RXN0-6452

Predicted SEED Role

"Possible ring-opening amidohydrolase RutC in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

• uracil degradation III (5/5 steps found)

Protein Sequence (138 amino acids)

>MIT1002_03466 Putative aminoacrylate peracid reductase RutC (Alteromonas macleodii MIT1002)
MHRKRNEKDKNMPKKAIIPAGTSTPIAPFVPGSMADNILYVSGTLPFDENNDVVHVGDAE
AQTRHVLETIKSVIEEAGGTMDDVTFNSIFITDWDDYAAVNKVYAEYFPGEKPARYCIKV
GLVKPEALIEIASVAHIG