Protein Info for MIT1002_03439 in Alteromonas macleodii MIT1002

Annotation: Cellulose synthase catalytic subunit [UDP-forming]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 741 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 54 (18 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 97 to 123 (27 residues), see Phobius details amino acids 418 to 440 (23 residues), see Phobius details amino acids 452 to 471 (20 residues), see Phobius details amino acids 527 to 547 (21 residues), see Phobius details amino acids 559 to 578 (20 residues), see Phobius details amino acids 715 to 731 (17 residues), see Phobius details TIGR03030: cellulose synthase catalytic subunit (UDP-forming)" amino acids 15 to 713 (699 residues), 789.9 bits, see alignment E=9.4e-242 PF13641: Glyco_tranf_2_3" amino acids 143 to 390 (248 residues), 75.1 bits, see alignment E=2.1e-24 PF00535: Glycos_transf_2" amino acids 147 to 333 (187 residues), 74.5 bits, see alignment E=2.9e-24 PF13506: Glyco_transf_21" amino acids 228 to 427 (200 residues), 50.2 bits, see alignment E=5.4e-17 PF13632: Glyco_trans_2_3" amino acids 244 to 457 (214 residues), 91.5 bits, see alignment E=1.9e-29 PF03552: Cellulose_synt" amino acids 336 to 444 (109 residues), 35.3 bits, see alignment E=1.6e-12 PF07238: PilZ" amino acids 582 to 679 (98 residues), 34.2 bits, see alignment E=8.3e-12

Best Hits

KEGG orthology group: K00694, cellulose synthase (UDP-forming) [EC: 2.4.1.12] (inferred from 92% identity to amc:MADE_00787)

Predicted SEED Role

"Cellulose synthase catalytic subunit [UDP-forming] (EC 2.4.1.12)" (EC 2.4.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (741 amino acids)

>MIT1002_03439 Cellulose synthase catalytic subunit [UDP-forming] (Alteromonas macleodii MIT1002)
MDYSQTRRQHYTSQFIIVLLVASFILGGLLLAPMDALGQLLSSIVILIAISLCSKEARHT
QKYQHLFRILALVLAIALSVRYLLWRGIYTLTYSDFLSMIAVWLLFGAEIYAGITSVLGA
IVNAFPLSRPLLSLEGVDKSTLPSVDVMIPSYNEDEGILEVTIRAAKMLDYPKEKLRIHL
LDDGGTDQKINAENPVSAATAKQRRQDLQALCKRLDITYHTRAKNEFAKAGNVNSAIQNT
TGDLIVILDADHVPTSDFLDRTVPWMLKNEKVFLVQTPHFMANPDPVERNYFSAFTRMPS
ENDMFYGTIQKGLDYWGSSFFCGSAALMRRKHLDLVGGISGDSITEDAETALDLHKMGYE
SVYVDRPMVSGLAPETFDAFIKQRMRWAQGMTQILLLKKPFKAQGLKWYQRVGYMSSIMF
WLFPFARIIFLLMPLAYLVFGLQVYHASMLEIFAFTLPHVIATYMISTMLFGRTRWPLVS
ELYEILQCAFTLNALIKVFLKPRAPSFVVTPKGESLDRTFVSPLSSVFYWLILVITFALG
SGVYKFITEPLTRELTVVVMLWNVFNLILLLSVLSVLLERKQVRSQARLPATNSVVIKTT
SDEAWVGDLVDLSLGGARLRLKGEGALVPENATLTSWSHALNKNVHLPISVLHYDNRSKI
LRVRFMPQTEEQENEVVAYSLCDSLRWMSFQRRRTRAISYWFGAKHVLKVGLKPVLLHML
VLMGKFAGKLGLLAKPAKENQ