Protein Info for MIT1002_03378 in Alteromonas macleodii MIT1002

Annotation: Phosphoadenosine phosphosulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02057: phosphoadenosine phosphosulfate reductase
  • amino acids 21 to 242 (222 residues), 284.2 bits, E=9.3e-89
• TIGR00434: phosophoadenylyl-sulfate reductase
  • amino acids 33 to 243 (211 residues), 271 bits, E=8.2e-85
• PF01507: PAPS_reduct
  • amino acids 48 to 219 (172 residues), 191.3 bits, E=7.8e-61

Best Hits

Swiss-Prot: 94% identical to CYSH_ALTMD: Phosphoadenosine phosphosulfate reductase (cysH1) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 94% identity to amc:MADE_03587)

MetaCyc: 65% identical to phosphoadenosine phosphosulfate reductase (Escherichia coli K-12 substr. MG1655)
Phosphoadenylyl-sulfate reductase (thioredoxin). [EC: 1.8.4.8]

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8)" in subsystem Cysteine Biosynthesis (EC 1.8.4.8)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.8

Protein Sequence (248 amino acids)

>MIT1002_03378 Phosphoadenosine phosphosulfate reductase (Alteromonas macleodii MIT1002)
MTNNTAIKQQPLTLDISKEALADINETLEKMTAQERVAWALDNLPDTHIVSSSFGAQSAV
MLHMLTQAQPDIPVVLTDTGYLFPETYKFIDELVEKLNLNLHVYSAEMSSAWQEARFGRL
WEQGIEGIEKYNKMNKVEPMQRALRDMKAGTWFAGLRRSQSDTRGKLPVLQKVGQQFKLY
PIIDWSNKDLHYYLKDNDLSYHPLWEQGYVSIGDWHTTQSLQEGMSEQDTRFFGLKRECG
LHEFGDGI