Protein Info for MIT1002_03352 in Alteromonas macleodii MIT1002

Annotation: Sulfite exporter TauE/SafE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 45 (17 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details PF01925: TauE" amino acids 13 to 268 (256 residues), 138.7 bits, see alignment E=1.3e-44

Best Hits

KEGG orthology group: None (inferred from 98% identity to amc:MADE_01459)

Predicted SEED Role

"Protein of unknown function DUF81" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>MIT1002_03352 Sulfite exporter TauE/SafE (Alteromonas macleodii MIT1002)
MEIELLWFVVTLCITGAIAGITAGLFGNGGGFVVVPALLAVFPFFTPPSEALVKVAIGTS
LASIVVSSARSVMAHRAKGAVDFDILRSWSIWLILGVGGGLLIANNSSANGLTVVFAAGV
LLYSVYFLFPEFVVRPGLVFDMPKGIGKAVLAFVLGGFSALLGIGGGTPTVITMVMCQRT
IQQAVATAAGVGFLIGLPGAIGFLFMKHPETASLPVGTIGYINIPALIAISIGAIFTAPI
GAKMAHNFSEKKLKRLFGIYLVIVSSAMFYKAI