Protein Info for MIT1002_03348 in Alteromonas macleodii MIT1002

Annotation: TVP38/TMEM64 family inner membrane protein YdjZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 738 transmembrane" amino acids 498 to 518 (21 residues), see Phobius details amino acids 539 to 571 (33 residues), see Phobius details amino acids 576 to 595 (20 residues), see Phobius details amino acids 639 to 663 (25 residues), see Phobius details amino acids 687 to 705 (19 residues), see Phobius details PF00614: PLDc" amino acids 132 to 155 (24 residues), 24.6 bits, see alignment (E = 3e-09) PF13091: PLDc_2" amino acids 267 to 399 (133 residues), 43.7 bits, see alignment E=3.8e-15 PF09335: VTT_dom" amino acids 558 to 673 (116 residues), 70.9 bits, see alignment E=2.1e-23

Best Hits

KEGG orthology group: None (inferred from 94% identity to amc:MADE_01463)

Predicted SEED Role

"COG1502: Phosphatidylserine/phosphatidylglycerophosphate/cardiolipi n synthases and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (738 amino acids)

>MIT1002_03348 TVP38/TMEM64 family inner membrane protein YdjZ (Alteromonas macleodii MIT1002)
MQSGKSVFQPGQNCWVESKARFSTPLIDCGNYYKALHSSIVKAKHSIFIVGWDIDSRIRL
LRGDDEANSEAPSVISDLLKWKAEQNPDIKIYLLRWDSSLAFFAQREMWAKEVWEEKTPD
NVQTELDDTIPMGGSQHQKIVVIDDELVFSGGMDVSTNRWDTRDHPVVSEERDGPDGEYG
PLHDVQMVSSGPVVADFSKLVRWRWQRVADSSPIDIREDARIDENAPLPDAWPQDYPPLF
EDVECALARTIPFMDEVEPAQEVRHMLLDLIGEAESVIYIENQFTTRQEIAEALNKQLKL
KPNLSVIIVSSYEPKGKFECEAFWASRIEFKEILEKGIDPKRVKLTYSSIEDMQGRKAYK
RIHSKVMTIDNKYLVIGSSNLSNRSMTLDTEIDTVLFGNTKDNQACIEQVRNDLLAEHTG
RDIDAMPALFNNEYPVEALMQDQIAHGYVLTEVRDEVFTEQSVKNVFRALSDPEEPLISV
PTFDGAAMPARNPRRRSIMILIGLAIIAVLGGLMFWASQSIPWLSSDSINAFLEKSRGTY
FALPTVLLVYVVGGVLFFPVTVLSLAVAAIFGPIWGPIYGIMGALMSSAIMFGIGKLSGN
AGLRKIGGPKVAAVDEKLKRSGIVGVAAIRMLPVAPFSLVNLVAGISSIGIFQFLVGTFL
GMFPPMIAKGLVGDSIAQIWQNPSVETISYLVGGIVLWGLMIWGSQKFARYYQARKESGN
QDTASDNSDKDEVEKCAA