Protein Info for MIT1002_03338 in Alteromonas macleodii MIT1002

Annotation: Thermophilic serine proteinase precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 840 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF22148: Fervidolysin_NPro-like" amino acids 26 to 111 (86 residues), 29.3 bits, see alignment E=2.3e-10 PF00082: Peptidase_S8" amino acids 158 to 421 (264 residues), 171.2 bits, see alignment E=8.1e-54 PF01483: P_proprotein" amino acids 591 to 669 (79 residues), 71.1 bits, see alignment E=1.8e-23 PF18911: PKD_4" amino acids 688 to 756 (69 residues), 69.6 bits, see alignment E=4.8e-23 PF00801: PKD" amino acids 689 to 754 (66 residues), 54.8 bits, see alignment 1.9e-18

Best Hits

KEGG orthology group: None (inferred from 93% identity to amc:MADE_01501)

Predicted SEED Role

"Serine protease, subtilase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (840 amino acids)

>MIT1002_03338 Thermophilic serine proteinase precursor (Alteromonas macleodii MIT1002)
MKTKPFKTGLSALSLALLPLMVSSHAHAAKAEIFDDSVIVVYKENVSKAEKMRARSSVRA
RISDANRDEVDDRFSNLLNGRIAKLELRGKSVKDAIEILKKNPAVKIAEPNFLYRKALVP
NDPSYGDLWGLNNTGQAGGTADVDIDAPEAWDITTGDSDVVIGVIDTGVDYNHEDLADNA
WINPGEIAGNGIDDDGNGYIDDVYGIDTANGDTDPMDDDSHGTHVAGTIGAVGGNGIGVV
GVNHDVSIAGCKFLGADGTGSTAGAIECIDYFTDLKENRGINIKATNNSWGGGGYSEALE
TAIEEAGQAGILFVAAAGNSGSNNDNVDNYPSNYVTTTNSLVAVASHTRTDGDSGFSYGI
ETVDIAAPGTAILSTIPGDGYATYSGTSMATPHVTGAAALVWSLNPDLTPSEMKELLMST
GETSLWADGRTVSGNRLNVLNALEEADPTPGFKLGITPGSAEIEAGETYTFTIEVGSIAG
YEEEVQLSLAEPSDIASLSASSAMPGDTVTLTVETSEETPWGPYSFTVNGVSGDIEKSKS
ANLYVYPQGLNEFPYAYSGDAVPTLPNEEDPDDVGVDLVINVPDDLTVFGMQASVDITHT
YSGDLVLSLTSPQGTTTVLRQNQGGGTDDIVESYNSDAFNGEVATGDWTLNVLDTFNGDN
GTVNTWSLVVTGIGEVGPTPPNSAFTYDASGLSVSFTNNSNDVNDDIVSYSWDFGDGSTS
TEENPTHVYASTGAYDVTLTVTDSEGQTGVSTETVSVSDSTIVAEIDRAMLSRFGSLRVD
LSYSGSMADTVMIYRNGELVEEVSNTGRYRDRSRGVQPGEYTYMVCDETSACSAPVSVNL