Protein Info for MIT1002_03330 in Alteromonas macleodii MIT1002

Annotation: L-lactate dehydrogenase [cytochrome]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF01070: FMN_dh" amino acids 13 to 374 (362 residues), 426 bits, see alignment E=5.6e-132

Best Hits

Swiss-Prot: 84% identical to LLDD_VIBPA: L-lactate dehydrogenase (lldD) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K00101, L-lactate dehydrogenase (cytochrome) [EC: 1.1.2.3] (inferred from 84% identity to vpa:VPA1499)

MetaCyc: 76% identical to L-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
1.1.5.M6 [EC: 1.1.5.M6]; RXN0-7227 [EC: 1.1.5.M6]

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.2.3)" in subsystem L-rhamnose utilization or Lactate utilization or Respiratory dehydrogenases 1 (EC 1.1.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.2.3

Use Curated BLAST to search for 1.1.2.3 or 1.1.5.M6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>MIT1002_03330 L-lactate dehydrogenase [cytochrome] (Alteromonas macleodii MIT1002)
MIISSPTDYRRAAQKILPPFLFHYIDGGAYREHTLKRNETDLADIALKQQVLRNMSSLDL
STTVFGEQLALPIALAPVGLTGMYARRGEVQAAKAAANKGIPFTMSTVSVCPIEEVAPAI
ERPMWFQLYVLRDRGFMKNVLERAKAAGVTTLVFTVDMPVPGARYRDKHSGMSGPFAASR
RVLQAMTHPRWAFDVGVFGKPHDLGNISTYRGEPTQLEDYIGWLGANFDPSISWKDLEWI
REFWDGPMIIKGILTEQDAKDALSFGAEGIVVSNHGGRQLDGVLSTAKALPAIASAVKGD
LSIFVDSGIRNGLDVVRMLALGADCTLLGRSFIYALAAEGQQGVENLLDLYKQEMHVAMT
LCGAKSVSELNLDSLAF