Protein Info for MIT1002_03328 in Alteromonas macleodii MIT1002

Annotation: High-affinity choline transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 transmembrane" amino acids 10 to 31 (22 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 184 to 209 (26 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 314 to 335 (22 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details amino acids 401 to 422 (22 residues), see Phobius details amino acids 447 to 466 (20 residues), see Phobius details amino acids 474 to 496 (23 residues), see Phobius details PF02028: BCCT" amino acids 13 to 495 (483 residues), 623.7 bits, see alignment E=9.3e-192 TIGR00842: transporter, betaine/carnitine/choline transporter (BCCT) family" amino acids 52 to 495 (444 residues), 498.4 bits, see alignment E=9e-154

Best Hits

KEGG orthology group: K02168, high-affinity choline transport protein (inferred from 92% identity to amc:MADE_01511)

Predicted SEED Role

"High-affinity choline uptake protein BetT" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (678 amino acids)

>MIT1002_03328 High-affinity choline transport protein (Alteromonas macleodii MIT1002)
MKGQVNNSTILLPVFLPAVVIILLLVIGTISNPELAGDAFDSTLAWITETFGWFYMLSVA
IFLVFIVSVASSSWGNIKLGPDHAEPQYSFPEWFSMLFSAGYGVALLYFGVAEPVLHYSS
PPAGAAETVDAAKQAMQIAFFHWGFHIWAIYGLVGLVLAYFAFRHGLPLSIRSALYPLIG
DKIYGPIGHAVDVFAILGTLFGIATTLGLSVTQINAGLNYLSGDIPIDIMVQVGTIAIVT
IAATISVVAGMDKGIKRLSILNMVLAVSLMSTVFIFGETVHILETFLQNTGSYINGIIER
TFNLQAYSRSDWIGNWTLFIFGWTIAWAPFVGMFIAKISRGRTIRQFVFGVMLVPTMFTF
LWFSVFGDTALNAIMNQGVTTLISDVQENEAVALFKLYDLLPGASIMSGLTVLLIITFFV
TSSDSGSLVIDSLASGGKEESPVWQRIFWACLEGTVAAVLLLAGGLNALQTMTIASALPF
AFIMLASAAGLWRALVIEGYRNNSLKANTLNRNHGRSTSLKGRLAAMVDYPSRNEVHEFI
DKTVIAAMKDVQAALKAREWEAFVKLDEETGRATFTVERHDHMDFIYDIRMTEYLVPGFS
YAELRSEEDESEKYFRAEVFLRRGGQAYDIYGYDKESITKDILDQFESYLHFLDTSPGEL
PWEMDAYDDMLTQPRGND