Protein Info for MIT1002_03327 in Alteromonas macleodii MIT1002

Annotation: 3-hydroxyisobutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF02826: 2-Hacid_dh_C" amino acids 2 to 93 (92 residues), 43.6 bits, see alignment E=6.6e-15 PF02737: 3HCDH_N" amino acids 3 to 53 (51 residues), 25.7 bits, see alignment 3.1e-09 PF03807: F420_oxidored" amino acids 3 to 93 (91 residues), 44.3 bits, see alignment E=6.7e-15 PF07991: KARI_N" amino acids 3 to 97 (95 residues), 36.5 bits, see alignment E=1.2e-12 PF03446: NAD_binding_2" amino acids 3 to 160 (158 residues), 175.2 bits, see alignment E=3.3e-55 TIGR01692: 3-hydroxyisobutyrate dehydrogenase" amino acids 6 to 289 (284 residues), 407.8 bits, see alignment E=1.3e-126 PF14833: NAD_binding_11" amino acids 163 to 288 (126 residues), 107.2 bits, see alignment E=2.1e-34

Best Hits

Swiss-Prot: 51% identical to MMSB_PSEAE: 3-hydroxyisobutyrate dehydrogenase (mmsB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00020, 3-hydroxyisobutyrate dehydrogenase [EC: 1.1.1.31] (inferred from 94% identity to amc:MADE_01512)

MetaCyc: 47% identical to 3-hydroxyisobutyrate dehydrogenase subunit (Pseudomonas putida)
3-hydroxyisobutyrate dehydrogenase. [EC: 1.1.1.31]

Predicted SEED Role

"3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 1.1.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>MIT1002_03327 3-hydroxyisobutyrate dehydrogenase (Alteromonas macleodii MIT1002)
MTTVAFIGLGNMGSGMADNLVKNDYNVLAFDLSEAALAKAKEAGCTIAQSTEQAAAEADI
VITMLPAGKHVKDIYSNQILASVREGTLLIDCSTIDVETAKSVSELAEKKGLKMLDAPVS
GGVAAAAGGTLTFMVGGDADAFDKAHGVLSAMGKKIVHAGGHGAGQAAKICNNMLLGATM
IATCESFQLAQKLGLDAQVFFDIASNASGQTWSMTTYCPVKGVGPQSPADNDFAGGFASA
LMLKDLGLAMQGAKGVNAQVPMGELAAKWFEMHCEEGNAGMDFSSIINRLA