Protein Info for MIT1002_03300 in Alteromonas macleodii MIT1002

Annotation: HTH-type transcriptional regulator UlaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF08220: HTH_DeoR" amino acids 6 to 61 (56 residues), 62.6 bits, see alignment E=3.6e-21 PF00455: DeoRC" amino acids 81 to 237 (157 residues), 126 bits, see alignment E=2.1e-40

Best Hits

KEGG orthology group: K03477, DeoR family transcriptional regulator, ulaG and ulaABCDEF operon transcriptional repressor (inferred from 48% identity to rde:RD1_3082)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>MIT1002_03300 HTH-type transcriptional regulator UlaR (Alteromonas macleodii MIT1002)
MLEKQRHQLILDILDEATFISVRDLCTQLNSSEATIRRDLNKLAAQNKLEKIRGGAQVIE
SRAVSNIRLSGNAFLVDREKNTNTKRMIAKAATEMCEDGESIIINGGSSTFMMSEFLVDR
RMNVLTNSFVLAHELLENSQNQVTLPGGEVYRKQSIILSSFENDTTQNYRGSKMFMGSPG
VSEFGVVEGDPLLILAEQKLRKRAEKLIVLADSSKIGVKGNLIFCGIKDVDTVITDSNAD
AATLQKLEDNGVNVIVVQACD