Protein Info for MIT1002_03289 in Alteromonas macleodii MIT1002

Annotation: Antilisterial bacteriocin subtilosin biosynthesis protein AlbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 TIGR02109: coenzyme PQQ biosynthesis enzyme PqqE" amino acids 16 to 371 (356 residues), 537.6 bits, see alignment E=1.3e-165 PF04055: Radical_SAM" amino acids 26 to 181 (156 residues), 108.9 bits, see alignment E=4.6e-35 PF13353: Fer4_12" amino acids 30 to 99 (70 residues), 25.9 bits, see alignment E=1.7e-09 PF13186: SPASM" amino acids 252 to 317 (66 residues), 40.6 bits, see alignment E=3.8e-14 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 252 to 344 (93 residues), 32.9 bits, see alignment E=6.7e-12

Best Hits

Swiss-Prot: 61% identical to PQQE_PSEF5: PqqA peptide cyclase (pqqE) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K06139, pyrroloquinoline quinone biosynthesis protein E (inferred from 80% identity to alt:ambt_01150)

MetaCyc: 59% identical to glutamate Cgamma--tyrosine C3 ligase (Klebsiella pneumoniae)
RXN-11176 [EC: 1.21.98.4]

Predicted SEED Role

"Coenzyme PQQ synthesis protein E" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.21.98.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>MIT1002_03289 Antilisterial bacteriocin subtilosin biosynthesis protein AlbA (Alteromonas macleodii MIT1002)
MTNNTDVDLQTDVSNTITPPLWLLAEITYQCPLHCPYCSNPVNMEETFNELSTEHWERVL
REAREMGAVQLGFSGGEPLLRKDLEHLVAYARALGFYTNLITSGIGMTEKRIAKLKEAGL
DHIQLSFQAANAEVNDLIGNKRHSFEQKLKIAKLVKQYNYPMVLNFCITAQNIHEIEDVM
ALSEQLNADFVELATVQYYGWAYENRDHLLPTSQQLQEAEAAVNRYRAQQNGKGPTFIFV
SPDYYESRPKACMNGWGTTFLTVTPDGSALPCHSAKILPLHFPNVKERSLHDIWHQDFSF
NHFRGDSWMPSPCRDCDEKDKDFGGCRCQAYLLTGDMYKTDPVCSKSPDHHLMKGITDKA
GTAPSKALQYRKVEKPIPILEVSATR