Protein Info for MIT1002_03278 in Alteromonas macleodii MIT1002

Annotation: Quinohemoprotein alcohol dehydrogenase ADH-IIG precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR04494: cytochrome c-550 PedF" amino acids 11 to 153 (143 residues), 127.4 bits, see alignment E=1.7e-41 PF00034: Cytochrom_C" amino acids 69 to 150 (82 residues), 29 bits, see alignment E=2.3e-10 PF13442: Cytochrome_CBB3" amino acids 71 to 149 (79 residues), 34 bits, see alignment E=3e-12

Best Hits

KEGG orthology group: None (inferred from 78% identity to alt:ambt_01205)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>MIT1002_03278 Quinohemoprotein alcohol dehydrogenase ADH-IIG precursor (Alteromonas macleodii MIT1002)
MKTKISMLFAALVVTGLSGHVLAHGNVIPQGADSSAMPPITDGDESENGWVFENPYRSLD
EETKTKVIKFGESAYANNCAGCHGLHAQSGGINPDLRELDPESFEDDEWFVERLRFGSAK
GMPALGGIPEGQTDPILDQETLWAIKTYVEARRVVAIEEGEIEAD