Protein Info for MIT1002_03274 in Alteromonas macleodii MIT1002

Annotation: Adenosylhomocysteinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05221: AdoHcyase
  • amino acids 19 to 129 (111 residues), 40.4 bits, E=4e-14
• PF02826: 2-Hacid_dh_C
  • amino acids 178 to 280 (103 residues), 49.9 bits, E=5e-17
• PF00670: AdoHcyase_NAD
  • amino acids 184 to 327 (144 residues), 125.6 bits, E=4.3e-40
• PF07991: IlvN
  • amino acids 190 to 255 (66 residues), 29 bits, E=1.6e-10

Best Hits

Swiss-Prot: 35% identical to SIHH_METJA: S-inosyl-L-homocysteine hydrolase (MJ1388) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01251, adenosylhomocysteinase [EC: 3.3.1.1] (inferred from 96% identity to amc:MADE_01521)

Predicted SEED Role

"Adenosylhomocysteinase (EC 3.3.1.1)" in subsystem Methionine Biosynthesis or Methionine Degradation (EC 3.3.1.1)

MetaCyc Pathways

• S-adenosyl-L-methionine salvage II (3/3 steps found)
• L-methionine degradation I (to L-homocysteine) (2/3 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (2/5 steps found)
• superpathway of L-methionine salvage and degradation (6/16 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.1.1

Protein Sequence (372 amino acids)

>MIT1002_03274 Adenosylhomocysteinase (Alteromonas macleodii MIT1002)
MYQDFQAELAWASLHMPRTRNAIASLPDLSNVKLACNMHLDLKMAPLVEGLLSRGCDIFL
TTCNPTTVQDDVVSYLVDKGATAHAWRDMSEADWSESFDKALAWQPTHLCEMGADLTTRL
HENIKANKPVPSIVSGLEATGSGINRLNGMAPNYPIFNWDDLPVKEGLHNRHMVGLSAWQ
TFFQTTHLTLHEKVVVVIGYGLVGQGVAASAKAFGAQVQVAELDPARALQAKYDGWPVVD
LNEAASQADVIATATGAYGVVNSSHLDNMKDGTFILNVGHVAQEIDVPYLKNNATHSEPM
PYVNAYKLGDKTLYLLADGSMFNLTAGYGDSINAFDVTLAVMAAGIGYIVNEGAKSEKGL
YLLPEAAWKSAL