Protein Info for MIT1002_03260 in Alteromonas macleodii MIT1002

Annotation: putative acetyl-CoA acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF00108: Thiolase_N" amino acids 4 to 184 (181 residues), 61.7 bits, see alignment E=1.8e-20 PF00109: ketoacyl-synt" amino acids 73 to 111 (39 residues), 23.6 bits, see alignment 9.1e-09 PF22691: Thiolase_C_1" amino acids 262 to 387 (126 residues), 118.1 bits, see alignment E=7e-38 PF02803: Thiolase_C" amino acids 267 to 367 (101 residues), 35 bits, see alignment E=2.5e-12

Best Hits

KEGG orthology group: None (inferred from 66% identity to cps:CPS_0669)

MetaCyc: 57% identical to 3-oxoacyl CoA thiolase (Aromatoleum aromaticum EbN1)
Acetyl-CoA C-acyltransferase. [EC: 2.3.1.16]

Predicted SEED Role

"3-ketoacyl-CoA thiolase (EC 2.3.1.16)" in subsystem Biotin biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Serine-glyoxylate cycle or n-Phenylalkanoic acid degradation (EC 2.3.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.16

Use Curated BLAST to search for 2.3.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>MIT1002_03260 putative acetyl-CoA acyltransferase (Alteromonas macleodii MIT1002)
MNNVKIIGAGMTKFVKPGSQLPYRIMASNAVESALKDADIDKKHIQQVFASYIYGDSTCG
QHAFYDVAQLGVPVVNVNNNCASGASAIYLARQAILSGEVDCAVAFGFEEMQPGALGSHW
QDRESPFDRFTPVYDEFDVPPAPIALRAFGSAGKHYMEKFGVSPNLFAEVSVKSRQHAIN
NPFSLFTSPLSVQEVLTDKVIFDSYLTRTMACPPTCGAAAVVLCSETFTKKHGITNAVSI
LGQGMATDTIDSWRDPISAVGSEMTKIASHKAYEAAAVSPNDIDVIELHDCFTTNEIITY
EALGLCLEGEAEKLVIDRDNTYGGKYVVGPSGGLMSKGHPIGATGIAQCVELSWHLTNRA
GQRQVENAKLALAHNIGLGGAAVVTILGAD