Protein Info for MIT1002_03255 in Alteromonas macleodii MIT1002

Annotation: Alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF08240: ADH_N" amino acids 29 to 130 (102 residues), 53 bits, see alignment E=5.6e-18 PF00107: ADH_zinc_N" amino acids 171 to 299 (129 residues), 104.3 bits, see alignment E=7e-34 PF13602: ADH_zinc_N_2" amino acids 203 to 332 (130 residues), 61.3 bits, see alignment E=3e-20

Best Hits

Swiss-Prot: 44% identical to YGD6_SCHPO: Zinc-type alcohol dehydrogenase-like protein C1773.06c (SPBC1773.06c) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 70% identity to alt:ambt_11935)

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>MIT1002_03255 Alcohol dehydrogenase (Alteromonas macleodii MIT1002)
MRKVVIGTHDEGLKRLKTTDVDEPQTVGSKEIKVRVHASSLNYHDLSVANGTIPTAQNRV
PLSDCSGIITQVGEDVDEFEEGDHVVSTFFPDWLNGEPRCSDFSRTPGDGLDGYATEYVV
RPATWFTKAPQGWSHAEAATITTAGLTAWRALVVEGKLKAGDKVLLLGTGGVSIYALQIA
KAMGAYVAITSSSDEKLEKAKALGADFIVNYKAEPEWGSAVNAWSGEKGVDHVVEVGGPA
TLAQSINACRVNGNIVLIGVLTGVKGDVPTAALMAKQINLKGIIVGSREHQNDFVNALEA
SGIKPVIDTSFSLDELAKAFEYEVNGKHFGKICIDI