Protein Info for MIT1002_03254 in Alteromonas macleodii MIT1002

Annotation: putative iron-regulated membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details amino acids 368 to 386 (19 residues), see Phobius details amino acids 397 to 415 (19 residues), see Phobius details amino acids 421 to 440 (20 residues), see Phobius details amino acids 446 to 468 (23 residues), see Phobius details PF03929: PepSY_TM" amino acids 15 to 358 (344 residues), 164 bits, see alignment E=3.8e-52

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>MIT1002_03254 putative iron-regulated membrane protein (Alteromonas macleodii MIT1002)
MSISISPSANKSALKSHAWLGLAVSVLMYWVCFSGTLSVFSQELLRWEQPHIADNLDYTP
GSIQNAYERFLTMKEGQTQGNIVIRLPTHDLPRARISADGEYWNISPTGELSEPSTTPIT
DLIVDLHTALHLPEDIGMMAVSVLGAILSALIISGIVAHRRIFKDAFRLRTGNNEQLTQG
DLHNRMSVWGLPFHLMIALTGVYFGLASFLTSIYADTLYEGNKLDLFADIYGSSIQLEHQ
PAIANIEKALTDIMKMEPNTQPIFVTLENATKDNQYILLGSQHLDKLIYSEQYRFDASGQ
YIDKVGYSDGDAGQQAIFSVYRIHFGHFGPEAMKIFFGLMGFALTIISVTGINLWLAKRA
KQDALNQLWLGFVWGTPIAFIWAALLELTLALPTKPVFWVTLTAILIASLMQKVLMKTHL
VLLNCLAALLVVLAITHFAVHYPSSLVMNSLIIDSAFIVFALCVWRYLYSRLKKGWNI