Protein Info for MIT1002_03243 in Alteromonas macleodii MIT1002

Annotation: Regulator of nucleoside diphosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 PF01272: GreA_GreB" amino acids 51 to 124 (74 residues), 51.7 bits, see alignment E=3.6e-18

Best Hits

KEGG orthology group: K06140, regulator of nucleoside diphosphate kinase (inferred from 56% identity to gag:Glaag_3959)

Predicted SEED Role

"Regulator of nucleoside diphosphate kinase" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>MIT1002_03243 Regulator of nucleoside diphosphate kinase (Alteromonas macleodii MIT1002)
MSRKPNITISYEDLSDIEEQLRKIKLPTERFDELEKELVRAKVVNIKDLAPDVVAIGSQV
TFKISKFDKYLTKTLCLPLDMHKYEDGISIFAPIGSALIGLRAGQKISWNTKSGEQQIDI
LEVKRKVRYLVCD