Protein Info for MIT1002_03151 in Alteromonas macleodii MIT1002

Annotation: Tyrosine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 TIGR00234: tyrosine--tRNA ligase" amino acids 8 to 398 (391 residues), 420.3 bits, see alignment E=4.5e-130 PF00579: tRNA-synt_1b" amino acids 31 to 317 (287 residues), 284.7 bits, see alignment E=1.3e-88 PF22421: SYY_C-terminal" amino acids 323 to 382 (60 residues), 33.5 bits, see alignment E=4.8e-12 PF13275: S4_2" amino acids 331 to 370 (40 residues), 26.9 bits, see alignment 5.7e-10

Best Hits

Swiss-Prot: 76% identical to SYY2_PSEHT: Tyrosine--tRNA ligase 2 (tyrS2) from Pseudoalteromonas haloplanktis (strain TAC 125)

KEGG orthology group: K01866, tyrosyl-tRNA synthetase [EC: 6.1.1.1] (inferred from 98% identity to amc:MADE_01620)

Predicted SEED Role

"Tyrosyl-tRNA synthetase (EC 6.1.1.1)" (EC 6.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>MIT1002_03151 Tyrosine--tRNA ligase (Alteromonas macleodii MIT1002)
MKDWQTALAEIKRGVDEILPEEDLIEKLKSGKTLTIKAGFDPTAPDLHLGHTVLINKLRT
FQQLGHKVVFLIGDFTGLIGDPTGKNVTRKPLSKEQVLENAKTYQEQVFKILDEDKTEIR
FNSEWMDGLGAAGMIKLAASQTVARMLERDDFKKRYNNGQPIAIHEFLYPLVQGWDSVAL
ESDVELGGTDQRFNLLMGRELQKEQGQKQQSIVMVPLLEGLDGVQKMSKSLNNYIGITDA
PNDMFGKVMSISDDLMWRYYDLLSFRPLEEIAELKTRVANGENPRDIKIMLAKEIIARFH
DDAAAEGAHQDFIQRFQKNAIPDDMPELEIALSDEGIAIGNLLKEANLVGSTSDAMRMIK
QGAVKINGDKVEDTRLVITEKGENVYQVGKRKFARITLA