Protein Info for MIT1002_03135 in Alteromonas macleodii MIT1002

Annotation: Bacterial membrane flanked domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 transmembrane" amino acids 67 to 85 (19 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 300 to 330 (31 residues), see Phobius details amino acids 434 to 455 (22 residues), see Phobius details amino acids 461 to 481 (21 residues), see Phobius details amino acids 528 to 545 (18 residues), see Phobius details PF03703: bPH_2" amino acids 115 to 190 (76 residues), 58.1 bits, see alignment E=4.3e-20 amino acids 480 to 554 (75 residues), 34.8 bits, see alignment E=8e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (568 amino acids)

>MIT1002_03135 Bacterial membrane flanked domain protein (Alteromonas macleodii MIT1002)
MTVSETPSHQAPTLNQSKELKEDAALKSHGQDANMEEPKLKVETGDEWQRLSLISILYFT
IRNFTNSAQVLIYSIPALAISFNIWDNLLSPEVLIGAGILFLSTSVSGVISFLMYKFRVH
NQHVEIHHGVFQRRYTNLPLWRIQNVKIEHPFYYRPFGYALVVLDTAGSGKEEAKIVAVP
EDYAEALKKQVLYEKALHDEGDLDCLPNEDLSDEQSSSFPTPRTRAKAVDSSHSNEEVLN
RRSVKDIIIHGITNNRVWIILGAAAPFYDDVFGLVSEWLADKGLQLNQLVGEQTVAWWQF
GLYAFVILMMLMALVALLSVGGALFTFYGYTLSRTGDRYIRRSGLLNKLEVSMRASRIQM
ITAKQDWLDKILKRVNLYFEQNSTAGQQMQELMSPNKLIVPSVTEDEAFALSQEVMPGCD
LRGQDYQTISKRFITFWLLAGWTLPFITFFTIGAVSSHLDIMLGSLVVFSAVSLLLTLRW
WRWGIAYDSKYVYIRRGRIGIDYQCFEPYKAQQVIVKQSVFMKRRKQATVKFVLASGAVT
VPFLPEDYVNKLADSVLFEVESTRRSWM