Protein Info for MIT1002_03120 in Alteromonas macleodii MIT1002

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 171 to 188 (18 residues), see Phobius details PF22765: DUF7010" amino acids 24 to 188 (165 residues), 68.8 bits, see alignment E=2.8e-23

Best Hits

KEGG orthology group: None (inferred from 83% identity to amc:MADE_03362)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>MIT1002_03120 hypothetical protein (Alteromonas macleodii MIT1002)
MEQVSHASSITPAQNASIPLEQQREDFKKNRFIAMPLAGTVVWALLGISAPFVSELTITW
LLYIGTGAIFYLGAGLSYLTGERFFAKKEAKNSFDRLFFVGMIMSLMVFAIALPVAAIDH
TTVPLSIGILAGLMWMPLSWAIEHWIGYFHTLTRTFGIVAAWYLFPDARVEAISAVIVAV
YIVSLITLERRFQSIKSN