Protein Info for MIT1002_03119 in Alteromonas macleodii MIT1002

Annotation: High-copy suppressor of rspA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 115 to 139 (25 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 204 to 222 (19 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 334 to 360 (27 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details amino acids 411 to 430 (20 residues), see Phobius details PF07690: MFS_1" amino acids 4 to 380 (377 residues), 143.9 bits, see alignment E=3.1e-46

Best Hits

KEGG orthology group: None (inferred from 90% identity to amc:MADE_03361)

Predicted SEED Role

"Methylenomycin A resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>MIT1002_03119 High-copy suppressor of rspA (Alteromonas macleodii MIT1002)
MEILDATVITTALPVIAADFNVPAAHLSIGVSAYLVAVTLFIPLSGYAADKFGARTIFVA
AIAVFTFASVLCGLSTSLFEFTLSRILQGLGGAMMVPVGRLVVLRDLPKEKLVKTVAIIT
WPALSAPLLGPVLGGYIATHFSWQWIFYMNIPLGIIAIIASLYLLKNIKGNVGKFDIKGF
LLTGIGFALFMAGIEFLASTSDKLIRPLGIIAIGLVLMVLAVKHVKTAKNPLFSFDAMQH
KTFRLTVFGGSVMRVALGSAPFLVPLMLQLGLGYSPVEAGSLLLWLFAGNLAIKPATTWI
MNTFGFKRVLVVNGVLIALGFVALAMINHSTSSFTIAVILFVNGITRSMHLTLINTIAFA
DVPPNKMRDANTLGAILMQMNRGLGITLSALAIAAAAFILGQSANMPNLQTFTLSMMFMA
AVALVSIYDSLMLSKEDGDSVLNKRKAKKARQT