Protein Info for MIT1002_03117 in Alteromonas macleodii MIT1002

Annotation: DnaA initiator-associating protein DiaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13580: SIS_2
  • amino acids 21 to 144 (124 residues), 104.8 bits, E=3.9e-34
• TIGR00441: phosphoheptose isomerase
  • amino acids 32 to 187 (156 residues), 210.1 bits, E=8.8e-67
• PF01380: SIS
  • amino acids 90 to 164 (75 residues), 30.9 bits, E=2.2e-11

Best Hits

Swiss-Prot: 98% identical to GMHA_ALTMD: Phosphoheptose isomerase (gmhA) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K12961, DnaA initiator-associating protein (inferred from 98% identity to amc:MADE_03359)

MetaCyc: 45% identical to D-sedoheptulose 7-phosphate isomerase (Aneurinibacillus thermoaerophilus)
RXN0-4301 [EC: 5.3.1.28]

Predicted SEED Role

"Phosphoheptose isomerase (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

• GDP-D-glycero-α-D-manno-heptose biosynthesis (1/4 steps found)
• ADP-L-glycero-β-D-manno-heptose biosynthesis (1/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Galactose metabolism
• Inositol phosphate metabolism
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.3.1.- or 5.3.1.28

Protein Sequence (198 amino acids)

>MIT1002_03117 DnaA initiator-associating protein DiaA (Alteromonas macleodii MIT1002)
MIEQIKANFTESIQTKIAASEILPEHIEKAAYMIVEALIRGNKVLSCGNGGSAGDAQHFA
SNMLNRYERDRPSLPAIALSTDTSTLTSIANDYNFEEIFAKQVRALGQPGDILLAISTSG
NSRNVIAAMEAALSRDMTIVALTGKDGGEMAGFLSEHDVEIRVPSNRTSRIQEVHLLVIH
NLCECIDDSLFPADHGDE