Protein Info for MIT1002_03099 in Alteromonas macleodii MIT1002

Annotation: ribose-5-phosphate isomerase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF02502: LacAB_rpiB" amino acids 4 to 113 (110 residues), 67.1 bits, see alignment E=1.6e-22 PF12408: DUF3666" amino acids 168 to 210 (43 residues), 60.2 bits, see alignment 8.9e-21

Best Hits

KEGG orthology group: None (inferred from 74% identity to mme:Marme_1204)

Predicted SEED Role

"predicted 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomerase (EC 5.3.1.17)" (EC 5.3.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.17

Use Curated BLAST to search for 5.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>MIT1002_03099 ribose-5-phosphate isomerase B (Alteromonas macleodii MIT1002)
MKVALMMENSQAAKNPVILNELTSVADSLGHAVFNVGMNSETDHHLTYVHLGIMGAILLN
SKAVDFVISGCGTGQGAMMSLNAHPGVFCGYCIDPSDAFLFNQVNNGNALALPFAKGFGW
GAELNARYIFEKALTGERGAGYPVERKEPQVRNAGILADLKRALAPESYVDSLKKMDVEL
VKTAVSGERFQQCLFDHGQDEEIKAYVKSLLA