Protein Info for MIT1002_03085 in Alteromonas macleodii MIT1002

Annotation: Homoserine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00191: homoserine kinase
  • amino acids 7 to 313 (307 residues), 291 bits, E=4.1e-91
• PF00288: GHMP_kinases_N
  • amino acids 65 to 156 (92 residues), 70.5 bits, E=1.2e-23
• PF08544: GHMP_kinases_C
  • amino acids 217 to 294 (78 residues), 53.7 bits, E=2.3e-18

Best Hits

Swiss-Prot: 57% identical to KHSE_VIBPA: Homoserine kinase (thrB) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K00872, homoserine kinase [EC: 2.7.1.39] (inferred from 94% identity to amc:MADE_03327)

MetaCyc: 53% identical to homoserine kinase (Escherichia coli K-12 substr. MG1655)
Homoserine kinase. [EC: 2.7.1.39]; 2.7.1.- [EC: 2.7.1.39]

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-threonine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Protein Sequence (314 amino acids)

>MIT1002_03085 Homoserine kinase (Alteromonas macleodii MIT1002)
MKAFTAFAPASIGNVSLGFDVLGAALAPVDGTKLGDEVEIKAAESFSLETVGRFAHKLPG
DADSNIVTKCYHYFCEQMEKAGKTTSPVALTLHKNLPIGSGLGSSASSIVAAFAALNAYF
DTPFDEDTLLIMMGELEGQISGSIHYDNVAPCYLGGMTLMTGSDAPVTLSLPLNDEWYYA
VCYSGISVSTAAARDILPKQVEMATALTFGRQLGVFVHALHVGNFDLAASVMNDVIAEPY
RKSLLPGFDDARAFSEQAGALAFGISGSGPTVFAVCPSKAQAEKVAAYLTENYIQNEDGF
SHVCQIPSQGTIVS