Protein Info for MIT1002_03075 in Alteromonas macleodii MIT1002

Annotation: Inner membrane transport protein YdhP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 34 to 58 (25 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 184 to 184 (1 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 359 to 380 (22 residues), see Phobius details amino acids 386 to 405 (20 residues), see Phobius details PF07690: MFS_1" amino acids 38 to 369 (332 residues), 137.2 bits, see alignment E=6.6e-44 PF00083: Sugar_tr" amino acids 52 to 205 (154 residues), 31.4 bits, see alignment E=9.8e-12

Best Hits

KEGG orthology group: K08156, MFS transporter, DHA1 family, arabinose polymer transporter (inferred from 98% identity to amc:MADE_03315)

Predicted SEED Role

"MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>MIT1002_03075 Inner membrane transport protein YdhP (Alteromonas macleodii MIT1002)
MTNQTDKILSDQASSKQAYSEQHSALGEYSLATITFWLAFGTFVIGCSEFAAMGLLPYFA
EDFGITENVAGHAISAYAIGVVVGAPLITIFFSRLARRTMLISMMVFYAGGNLLTALAWS
EWTMNIARFIAGLPHGAYFGIAMLFAADIAGKNKRAQAVSNVILGLAIANIIGVPSISGI
GQMFGWRTGFFIISAFALVTALMVWKTAPYRGPNPDAKPLTELKALKNKDVLLVLLMGAI
GFGGMFSVYSYFSASYLNTTSSPEWGISATLLIYGIGVTLGNIIAGRYSEGRLLTSAITF
QVLLGLSAAAYAASMGNPYLMAASLFFIGIGGGMVVPLQTRLMDVAGEAQTLAGAMNHAA
FNTANALGPWLAGMTLSAGYGYTSTGWVGLALAGGGVLVWLAIVMTARNTQVQTATVSG