Protein Info for MIT1002_03029 in Alteromonas macleodii MIT1002

Annotation: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01225: Mur_ligase
  • amino acids 26 to 90 (65 residues), 33.4 bits, E=7.3e-12
• TIGR01143: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  • amino acids 31 to 451 (421 residues), 454.3 bits, E=2.1e-140
• PF08245: Mur_ligase_M
  • amino acids 107 to 296 (190 residues), 165.8 bits, E=1.9e-52
• PF02875: Mur_ligase_C
  • amino acids 317 to 387 (71 residues), 42.3 bits, E=1.1e-14

Best Hits

Swiss-Prot: 48% identical to MURF_ECOLI: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase (murF) from Escherichia coli (strain K12)

KEGG orthology group: K01929, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase [EC: 6.3.2.10] (inferred from 92% identity to amc:MADE_03262)

MetaCyc: 48% identical to D-alanyl-D-alanine-adding enzyme (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase. [EC: 6.3.2.10]

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.10)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (6/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (10/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (11/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (11/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (10/17 steps found)

KEGG Metabolic Maps

• Lysine biosynthesis
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.10

Protein Sequence (469 amino acids)

>MIT1002_03029 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase (Alteromonas macleodii MIT1002)
MITTTLSWIAEKVNGKLLKGAADVEVSAVSTDTRTLEDGAVYLALKGPNFNGHDFISTAE
KAGASAVIASEDVATSLPVIMVEDTKEALGLLGAAVKAYVAPKTIAITGSSGKTTVKEMC
AAILERRGNVLATNGNFNNDIGVPLTLLRLEPQHEYAVMELGANHIGEIAYTTNLVKPDV
ATIVNAAASHLEGFGSLLGVARAKSEIFKGLGSDGVAVVNVDSQFAEFWQGKLKQTKTLT
FSPQQKNDADFRAEDITIGLDGCAAFHLVCPRGDMSIQLTIPGVHNVGNALVAAALTLQV
GATLENVRDGLLAMKQVSGRLNVKQLTEQVRLLDDTYNANVASVNAAIDTLSSFSGIRVL
VLGDMKELGEKARFYHEQVGEYAKQKGINYLYTMGVLSQSASAVFNENGGHFSDVESLLA
AMESDLLVQQRDISILVKGSRSSRMERVVEAVEASALGKHDSRRERIAC