Protein Info for MIT1002_03027 in Alteromonas macleodii MIT1002

Annotation: UDP-N-acetylmuramoylalanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 323 to 342 (20 residues), see Phobius details PF21799: MurD-like_N" amino acids 9 to 105 (97 residues), 54.8 bits, see alignment E=1.5e-18 TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase" amino acids 11 to 488 (478 residues), 382.6 bits, see alignment E=1.5e-118 PF08245: Mur_ligase_M" amino acids 129 to 331 (203 residues), 96.5 bits, see alignment E=3.2e-31 PF02875: Mur_ligase_C" amino acids 353 to 424 (72 residues), 30.9 bits, see alignment E=4.3e-11

Best Hits

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (505 amino acids)

>MIT1002_03027 UDP-N-acetylmuramoylalanine--D-glutamate ligase (Alteromonas macleodii MIT1002)
MSYNVREHSYVVGGLGVTGQACVRFLLQKQATVKAFDTRANFTLVTDPDSDIDTDMQAFM
AEKVTCTALSEDYFDGVDTLVLSPGLALNIEQVVLAQKCGVEVIGDVELFARLNASTSDA
TPAKRVVGITGSNGKTTVTLLVNHLLKSCGVKSIEAGNVGRPVLEALQSDADVVVMELSS
FQLETTSSLVLEAATVLNISDDHLDRHGTLEAYIDAKHRIFDNAKSAIVWRDGEFVAPDE
QIIADAKGNAASNAVSDGESNAASNEESLASKNIVEYGLGESTTGLAIASFDGDDEQSLY
ITFKGEKLIALSDIHLAGMHNVLNIMAALGICLQLGVSPALAVKHLHSFKAAPHRCVEIA
RVNDIRYIDDSKATNIGANIAALEGLAPTIQGKLILIAGGDAKGADIASLSPYLTKYVSH
VFALGKDAHLFEKSFAHTTRVATMKDAVKAATRLAAPGDVVLLSPACASLDMFKNYMHRG
DVFKQDVHDLLNLHSKNDDAVEATS