Protein Info for MIT1002_03008 in Alteromonas macleodii MIT1002

Annotation: Nicotinate-nucleotide pyrophosphorylase [carboxylating]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)" amino acids 15 to 283 (269 residues), 311.2 bits, see alignment E=2.6e-97 PF02749: QRPTase_N" amino acids 32 to 116 (85 residues), 80.1 bits, see alignment E=1.1e-26 PF01729: QRPTase_C" amino acids 119 to 282 (164 residues), 194.9 bits, see alignment E=8.8e-62

Best Hits

Swiss-Prot: 58% identical to NADC_ECOLI: Nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC) from Escherichia coli (strain K12)

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 93% identity to amc:MADE_03230)

MetaCyc: 58% identical to quinolinate phosphoribosyltransferase (decarboxylating) (Escherichia coli K-12 substr. MG1655)
Nicotinate-nucleotide diphosphorylase (carboxylating). [EC: 2.4.2.19]

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>MIT1002_03008 Nicotinate-nucleotide pyrophosphorylase [carboxylating] (Alteromonas macleodii MIT1002)
MKMTSPDMQAIREQVSNALIEDLGGELNAANDITANLIDESVNAKATIITREPCVVCGIA
WANQAFALIDESVSLTWHVKDGDKVDANTVLVSLEGSARAILTAERTALNFLQTLSATAT
VTAFYAKYLDGSDTKILDTRKTLPGLRHAQKYAVRCGGGQNHRVGLFDAFLIKENHIFSC
GNIEKAVSRAKTMMPGKPVEVEVESLTELEQALGAGADIVMLDNFSNEQIQQAVALNKGQ
CKLEVSGNITDERLASLAKLGVDYISSGALTKHVQAIDLSLRINLS