Protein Info for MIT1002_03005 in Alteromonas macleodii MIT1002

Annotation: regulatory protein AmpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 59 to 80 (22 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 282 to 299 (18 residues), see Phobius details PF17113: AmpE" amino acids 1 to 299 (299 residues), 99.6 bits, see alignment E=1.1e-32

Best Hits

KEGG orthology group: K03807, AmpE protein (inferred from 87% identity to amc:MADE_03227)

Predicted SEED Role

"AmpE protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>MIT1002_03005 regulatory protein AmpE (Alteromonas macleodii MIT1002)
MMLMSLLLVLSLERLITKTPNWHIEKYAAQYRAFLQDKGLIKFQEGNEGEERSKKVSSAA
LYFFLLLPAVVLGAIEYWVLGAFLTFIEQSIILFICIGCPALRAVYKSFLNAADRGDLQA
CSMYTDQLGHCASQTVSDGSAGTEGKTFGQHLTWLNYQHYAAVMLWFIAFGAPGALFYSL
SRSTTEALCSANHPLKGAAGRLMFALDYIPVRVTAFGMLMMGHFSRALPEWIKYALQFDV
PAYDVLTQISSKAEILTPDEQQLQAENAAIEPKLLVKLAKRNVIFLLVITSALTLVGSLA