Protein Info for MIT1002_03002 in Alteromonas macleodii MIT1002

Annotation: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 6 to 75 (70 residues), 57.4 bits, E=2.6e-19
  • amino acids 129 to 200 (72 residues), 66.7 bits, E=3.4e-22
  • amino acids 246 to 317 (72 residues), 69.6 bits, E=4.1e-23
• TIGR01348: dihydrolipoyllysine-residue acetyltransferase
  • amino acids 213 to 683 (471 residues), 613.7 bits, E=1.7e-188
• PF02817: E3_binding
  • amino acids 377 to 411 (35 residues), 60.9 bits, see alignment (E = 2.6e-20)
• PF00198: 2-oxoacid_dh
  • amino acids 452 to 682 (231 residues), 258.8 bits, E=1.1e-80

Best Hits

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 91% identity to amc:MADE_03224)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.12

Protein Sequence (683 amino acids)

>MIT1002_03002 Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (Alteromonas macleodii MIT1002)
MSDIQKIIVPDVGGDEVEVIELCVAVGDNIEADEGVVTVESDKASMDIPAPFEGEIVSLT
VSVGDKIKEGDVIGEMKVANGDSADKGASEENASDESSKEDAPKQEEAPKDESKSEAAPA
ASGSSEVIEVAVPDIGSDDEVDVIDVLVSVGDTIEKEDGLITLETDKATMDVPSTHAGTV
KEVFISTGDKVKEGTVVIKLEVAGSGSSSSESASSDASSEASAPAAPESAKQESAPAASA
GSETIEVAVPDIGEDGEVDVIDVLVSAGDTVEKEDGLITLETDKATMDVPSTHAGTIKEV
FIKAGDKVKQGTLVVKLETSGGSSSSAAEKPAEAPKQEETKQDSQQDETQQASQQEASQG
RSPVPPAPEAKNTGKAHASPSVRRIAREFGVDLTQVNGSGPKNRILKEDVQAYVKAELAK
PRTAAASGSAPVGDNVLQIVPVKPVDHSKFGEIEEQKLSRIQKISGPFLHRNWATIPHVT
QFDEADITEVEEFRKEQNAYHAKIKSGLKITPLVFVMKAVAKALEKYEVFNSSLSDDGES
LIIKKFINIGIAVETPGGLVVPVIRDVNKKGIEQLSQELIETSKKAREGKLKAADMQGGT
FTISSLGGIGGTAFTPIVNAPEVAILGVSKSEMKPKWNGKEFEPRLMVPLSLSYDHRVID
GAVGARFSTEVAANLTDLRRIIL