Protein Info for MIT1002_02972 in Alteromonas macleodii MIT1002

Annotation: Glycine cleavage system H protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 TIGR00527: glycine cleavage system H protein" amino acids 3 to 128 (126 residues), 183 bits, see alignment E=1.1e-58 PF01597: GCV_H" amino acids 8 to 128 (121 residues), 160.1 bits, see alignment E=1.1e-51

Best Hits

Swiss-Prot: 96% identical to GCSH_ALTMD: Glycine cleavage system H protein (gcvH) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 96% identity to amc:MADE_00862)

MetaCyc: 67% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (129 amino acids)

>MIT1002_02972 Glycine cleavage system H protein (Alteromonas macleodii MIT1002)
MSNIPTDLRYAATHEWVRPEGDGVFTVGISEHAQGLLGDMVFVDLPDVGDAVSTGDDVCV
AESVKAASDVYAPISGEIVAINEDLEDSPELVNSDPYGDGWLFKIKADDAAEVEGLLDAE
GYENSIDEE